PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr034730.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family MYB_related
Protein Properties Length: 365aa    MW: 39633.3 Da    PI: 8.1492
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr034730.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding39.51.3e-12112156347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT++E+  ++ + ++lG+g+W+ Iar   ++Rt+ q+ s+ qky
      Pbr034730.1 112 PWTEDEHRMFLIGLQKLGKGDWRGIARSYVTTRTPTQVASHAQKY 156
                      8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129419.209105161IPR017930Myb domain
SuperFamilySSF466891.01E-16107162IPR009057Homeodomain-like
TIGRFAMsTIGR015576.4E-18108160IPR006447Myb domain, plants
SMARTSM007172.8E-9109159IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.4E-10109155IPR009057Homeodomain-like
PfamPF002493.6E-10112156IPR001005SANT/Myb domain
CDDcd001671.97E-8112157No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009739Biological Processresponse to gibberellin
GO:0009753Biological Processresponse to jasmonic acid
GO:0046686Biological Processresponse to cadmium ion
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 365 aa     Download sequence    Send to blast
MTRRCSHCSN NGHNSRTCPT RVGSSSSSPS LGGGVKLFGV RLTDGSIIKK SASMGNLSSA  60
AAHYHSSSPN PDSPSSDPLH DPVHVPDGYL SDDPAHASSS VNRRGDRKKG TPWTEDEHRM  120
FLIGLQKLGK GDWRGIARSY VTTRTPTQVA SHAQKYFIRQ SNATRRKRRS SLFDMVPDMA  180
PPLPEEQIFL PSSWEGDSED ANSLPSLNLS LSSESKPMET THEETVIEHD HEPAMGSNGF  240
PPMPPPYVPA YMSYPWPYWA PSAGPFREMV GEPSRQPVLR PIPIVPKEPV NVDALGMSQL  300
SLGEAERGVK EPSPLSLKLL GEPSRQSAFH TNPXXXXRQS AFHPNAPASE PDLSKGKSSA  360
IQAV*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ0744750.0DQ074475.1 Malus x domestica MYBR2 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001280790.10.0uncharacterized protein LOC103443746
TrEMBLQ2LMD70.0Q2LMD7_MALDO; MYBR2
STRINGGLYMA13G43120.11e-142(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF77193346
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G16350.13e-81MYB_related family protein